Recombinant Human Frizzled-7/FZD7 Protein
Product Sizes
10 ug
£127.00
RP00204-10UG
20 ug
£175.00
RP00204-20UG
50 ug
£240.00
RP00204-50UG
100 ug
£336.00
RP00204-100UG
500 ug
£1002.00
RP00204-500UG
1000 ug
£1574.00
RP00204-1000UG
About this Product
- SKU:
- RP00204
- Additional Names:
- FZD7,FzE3
- Extra Details:
- Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. During development, Frizzled-7 is expressed during gastrulation and in the fetal gut, kidney and lung where it is thought to influence tissue morphogenesis via non-canonical signaling pathways . In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling . Frizzled-7 expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
- Formulation:
- Recombinant Human Frizzled-7/FZD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln33-Leu185) of human Frizzled-7 (Accession #NP_003498.1) fused
- Immunogen:
- Gln33-Leu185
- Molecular Weight:
- 55-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00204
