Recombinant Human Cripto-1/TDGF1 Protein
Product Sizes
10 ug
£163.00
RP00202-10UG
20 ug
£223.00
RP00202-20UG
50 ug
£336.00
RP00202-50UG
500 ug
£1478.00
RP00202-500UG
1000 ug
£2335.00
RP00202-1000UG
About this Product
- SKU:
- RP00202
- Additional Names:
- TDGF1,CR,CRGF,CRIPTO
- Extra Details:
- Cripto/TDGF1 is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. TDGF1 is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. It is overexpressed in many types of cancers and acts as a growth factor for tumors. Cripto mutants display defects in mesoderm induction and heart morphogenesis, similar to phenotypes seen in Nodal mutants. Cripto can also activate mitogen-activated protein kinase (MAPK) and Akt pathways independently of Nodal by directly binding to a membrane-associated heparan sulfate proteoglycan, glypican-1.
- Formulation:
- Recombinant Human Cripto-1/TDGF1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu31-Thr172) of human Cripto/TDGF1 (Accession #NP_003203) fused
- Immunogen:
- Leu31-Thr172
- Molecular Weight:
- 20-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00202
