Recombinant Human GDNFR-alpha-2/GFRA2 Protein
Product Sizes
10 ug
£107.00
RP00199-10UG
20 ug
£133.00
RP00199-20UG
100 ug
£240.00
RP00199-100UG
500 ug
£645.00
RP00199-500UG
1000 ug
£1002.00
RP00199-1000UG
About this Product
- SKU:
- RP00199
- Additional Names:
- GFRA2,GDNFRB,NRTNR-ALPHA,NTNRA,RETL2,TRNR2
- Extra Details:
- Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases.
- Formulation:
- Recombinant Human GDNFR-alpha-2/GFRA2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser22-Ser441) of human GFRA2/GFRA Alpha2/GDNFRB (Accession #NP_001
- Immunogen:
- Ser22-Ser441
- Molecular Weight:
- 70-75 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00199


