Recombinant Human Azurocidin/CAP37/AZU1 Protein
Product Sizes
10 ug
£127.00
RP00196-10UG
20 ug
£175.00
RP00196-20UG
50 ug
£240.00
RP00196-50UG
100 ug
£336.00
RP00196-100UG
500 ug
£1002.00
RP00196-500UG
1000 ug
£1574.00
RP00196-1000UG
About this Product
- SKU:
- RP00196
- Additional Names:
- AZU1,AZAMP,AZU,CAP37,HBP,HUMAZUR,NAZC,hHBP
- Extra Details:
- Azurocidin (AZU1), also known as heparin-binding protein (HBP) or cationic antimicrobial protein 37 (CAP37), is an azurophil granule antibiotic protein, with monocyte chemotactic and antibacterial activity. The Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. Azurocidin is a member of the serine protease family that includes Cathepsin G, neutrophil elastase (NE), and proteinase 3 (PR3). Azurocidin has also been identified as a modulator of endothelial permeability. Neutrophils arriving first at sites of inflammation release Azurocidin, which acts in a paracrine fashion on endothelial cells causing the development of intercellular gaps and allowing leukocyte extravasation. These findings imply that Azurocidin may be a reasonable therapeutic target for a variety of inflammatory disease conditions.
- Formulation:
- Recombinant Human Azurocidin/CAP37/AZU1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile27-Pro250) of human AZU1/Azurocidin 1/CAP37 (Accession
- Immunogen:
- Ile27-Pro250
- Molecular Weight:
- 40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00196
