Recombinant Human Fetuin A/AHSG Protein
Product Sizes
10 ug
£127.00
RP00195-10UG
20 ug
£175.00
RP00195-20UG
50 ug
£240.00
RP00195-50UG
100 ug
£336.00
RP00195-100UG
500 ug
£1002.00
RP00195-500UG
1000 ug
£1574.00
RP00195-1000UG
About this Product
- SKU:
- RP00195
- Additional Names:
- AHSG, A2HS, AHS, FETUA, HSGA, alpha-2-HS-glycoprotein
- Extra Details:
- Fetuin-A, also known as Alpha-2-HS-Glycoprotein (AHSG), belongs to the Fetuin family.It is a major plasma protein and a member of the cystatin superfamily of protease inhibitors.It is expressed by hepatocytes, the principal cell source, and by monocyte/macrophages. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues.
- Formulation:
- Recombinant Human Fetuin A/AHSG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-Val367) of human Fetuin-A/AHSG/FETUA (Accession #NP_001613.2
- Immunogen:
- Ala19-Val367
- Molecular Weight:
- 48-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00195


