Recombinant Human IL-22RA2/IL22BP Protein
Product Sizes
10 ug
£145.00
RP00192-10UG
20 ug
£193.00
RP00192-20UG
50 ug
£288.00
RP00192-50UG
500 ug
£1240.00
RP00192-500UG
1000 ug
£1954.00
RP00192-1000UG
About this Product
- SKU:
- RP00192
- Additional Names:
- IL22RA2,CRF2-10,CRF2-S1,CRF2X,IL-22BP,IL-22R-alpha-2,IL-22RA2,ZCYTOR16
- Extra Details:
- Interleukin 22 binding protein (IL-22BP), also known as CRF2-10, CRF2-X, and IL-22RA2, is a 35-45 kDa secreted glycoprotein in the type II cytokine receptor family (CRF). IL-22BP specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor.IL-22BP is produced by dendritic cells (DC), epithelial cells, activated B cells, and activated monocytes. It is constitutively expressed by DC but is down-regulated during local inflammation and in response to tissue damage. IL-22BP is critical for limiting IL-22 induced epithelial cell proliferation during wound healing, and its deficiency can enable uncontrolled proliferation and enhance tumor development.
- Formulation:
- Recombinant Human IL-22RA2/IL22BP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr22-Pro231) of human IL-22BP/IL-22RA2 (Accession #NP_851826.1)
- Immunogen:
- Thr22-Pro231
- Molecular Weight:
- 40-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00192
