Recombinant Human IL-22RA2/IL22BP Protein
Product Sizes
10 ug
£145.00
RP00192-10UG
20 ug
£193.00
RP00192-20UG
50 ug
£288.00
RP00192-50UG
About this Product
- SKU:
- RP00192
- Additional Names:
- IL22RA2,CRF2-10,CRF2-S1,CRF2X,IL-22BP,IL-22R-alpha-2,IL-22RA2,ZCYTOR16
- Extra Details:
- Recombinant Human IL-22RA2/IL22BP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr22-Pro231) of human IL-22BP/IL-22RA2 (Accession #NP_851826.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Thr22-Pro231
- Molecular Weight:
- 25.33 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00192
