Recombinant Human TNFSF11/RANKL/CD254 Protein
Product Sizes
10 ug
£163.00
RP00183-10UG
20 ug
£223.00
RP00183-20UG
50 ug
£336.00
RP00183-50UG
100 ug
£508.00
RP00183-100UG
500 ug
£1478.00
RP00183-500UG
1000 ug
£2335.00
RP00183-1000UG
About this Product
- SKU:
- RP00183
- Additional Names:
- TNFSF11,CD254,ODF,OPGL,OPTB2,RANKL, TNLG6B,TRANCE,hRANKL2,sOdf
- Extra Details:
- Tumor necrosis factor ligand superfamily member 11, also known as Receptor activator of nuclear factor kappa-B ligand, Osteoprotegerin ligand, TNFSF11, RANKL, TRANCE, OPGL and CD254, is a single-pass type II membrane protein which belongs to the tumor necrosis factor family. TNFSF11 is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. TNFSF11 was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy.
- Formulation:
- Recombinant Human TNFSF11/RANKL/CD254 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly136-Asp317) of human TRANCE/RANK L/TNFSF11 (Accession #NP
- Immunogen:
- Gly136-Asp317
- Molecular Weight:
- 35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00183
