Recombinant Human TNFRSF11B/Osteoprotegerin Protein
Product Sizes
10 ug
£115.00
RP00180-10UG
20 ug
£145.00
RP00180-20UG
50 ug
£193.00
RP00180-50UG
100 ug
£276.00
RP00180-100UG
500 ug
£764.00
RP00180-500UG
1000 ug
£1193.00
RP00180-1000UG
About this Product
- SKU:
- RP00180
- Additional Names:
- TNFRSF11B, OCIF, OPG, PDB5, TR1, TNF receptor superfamily member 11b,Osteoprotegerin,OCIF,OPG,PDB5,TR1
- Extra Details:
- Osteoprotegerin or TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification.
- Formulation:
- Recombinant Human TNFRSF11B/Osteoprotegerin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu22-Leu401) of human Osteoprotegerin/TNFRSF11B (Accession
- Immunogen:
- Glu22-Leu401
- Molecular Weight:
- 55-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00180
