Recombinant Human TNFRSF11B/Osteoprotegerin Protein
Product Sizes
10 ug
£115.00
RP00180-10UG
20 ug
£145.00
RP00180-20UG
50 ug
£193.00
RP00180-50UG
100 ug
£276.00
RP00180-100UG
About this Product
- SKU:
- RP00180
- Additional Names:
- TNFRSF11B, OCIF, OPG, PDB5, TR1, TNF receptor superfamily member 11b,Osteoprotegerin,OCIF,OPG,PDB5,TR1
- Extra Details:
- Recombinant Human TNFRSF11B/Osteoprotegerin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu22-Leu401) of human Osteoprotegerin/TNFRSF11B (Accession #NP_002537.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Glu22-Leu401
- Molecular Weight:
- 44.46 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00180










