Recombinant Human NKp30/NCR3/CD337 Protein
Product Sizes
10 ug
£133.00
RP00179-10UG
20 ug
£181.00
RP00179-20UG
50 ug
£240.00
RP00179-50UG
100 ug
£353.00
RP00179-100UG
About this Product
- SKU:
- RP00179
- Additional Names:
- NCR3,1C7,CD337,LY117,MALS,NKp30
- Extra Details:
- Recombinant Human NKp30/NCR3/CD337 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu19-Thr138) of human NCR3/NKp300 (Accession #NP_001138938.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu19-Thr138
- Molecular Weight:
- 39.86 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00179
