Recombinant Human Flt3 ligand/Flt3L Protein
Product Sizes
10 ug
£133.00
RP00175-10UG
20 ug
£181.00
RP00175-20UG
50 ug
£240.00
RP00175-50UG
100 ug
£353.00
RP00175-100UG
500 ug
£1002.00
RP00175-500UG
1000 ug
£1574.00
RP00175-1000UG
About this Product
- SKU:
- RP00175
- Additional Names:
- FL,FLT3L,FLT3LG,FLT3LG
- Extra Details:
- FLT3LG, also known as flt3 ligand, is a small molecule that acts as a growth factor that increases the number of immune cells by activating the hematopoietic progenitors .FLT3LG is expressed as a noncovalently-linked dimer by T cells and bone marrow and thymic fibroblasts. Alternate splicing of human FLT3LG also generates membrane-associated isoforms that contain either a truncated cytoplasmic tail or an 85 aa substitution following the cytokine domain. Both transmembrane and soluble FLT3LG signal through the tyrosine kinase receptor Flt-3/Flk-2. FLT3LG induces the expansion of monocytes and immature dendritic cells as well as early B cell lineage differentiation. It synergizes with IL-3, GM-CSF, and SCF to promote the mobilization and myeloid differentiation of hematopoietic stem cells. It cooperates with IL-2, -6, -7, and -15 to induce NK cell development and with IL-3, -7, and -11 to induce terminal B cell maturation.
- Formulation:
- Recombinant Human Flt3 ligand/Flt3L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr27-Pro185) of human FLT3L/Flt3 ligand/FLT3LG (Accession #NP
- Immunogen:
- Thr27-Pro185
- Molecular Weight:
- 20-37 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00175
