Recombinant Human Thrombopoietin/THPO Protein
Product Sizes
10 ug
£163.00
RP00174-10UG
20 ug
£223.00
RP00174-20UG
50 ug
£336.00
RP00174-50UG
100 ug
£508.00
RP00174-100UG
500 ug
£1478.00
RP00174-500UG
1000 ug
£2335.00
RP00174-1000UG
About this Product
- SKU:
- RP00174
- Additional Names:
- THPO,MGDF,MKCSF,ML,MPLLG,THCYT1,TPO
- Extra Details:
- Thrombopoietin (TPO or THPO), also known as myeloproliferative leukemia virus ligand (c-Mpl), is a hematopoietic growth factor belonging to the EPO/TPO family. Megakaryocytopoiesis is the cellular development process that leads to platelet production. TPO is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. TPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in TPO gene are the cause of thrombocythemia .
- Formulation:
- Recombinant Human Thrombopoietin/THPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Gly353) of human Thrombopoietin/THPO (Accession #NP_00
- Immunogen:
- Ser22-Gly353
- Molecular Weight:
- 70-90 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00174


