Recombinant Human IL-12A/IL-12 p35 Protein
Product Sizes
20 ug
£193.00
RP00173-20UG
50 ug
£288.00
RP00173-50UG
100 ug
£431.00
RP00173-100UG
500 ug
£1240.00
RP00173-500UG
1000 ug
£1954.00
RP00173-1000UG
About this Product
- SKU:
- RP00173
- Additional Names:
- P35, CLMF, NFSK, NKSF1, IL-12A,IL12A
- Extra Details:
- Interleukin-12 subunit alpha (IL12A/IL-12p35) is also known as Cytotoxic lymphocyte maturation factor 35 kDa subunit, cytotoxic lymphocyte maturation factor 1, p35, NK cell stimulatory factor chain 1, and interleukin-12 alpha chain. IL12A/IL-12p35 is a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.
- Formulation:
- Recombinant Human IL-12A/IL-12 p35 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg23-Ser219) of human IL12A/NKSF1 (Accession #NP_002178.2) fused wit
- Immunogen:
- Arg23-Ser219
- Molecular Weight:
- 70 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00173
