Recombinant Human MHC class I polypeptide-related sequence A/MIC-A Protein
Product Sizes
10 ug
£127.00
RP00172-10UG
20 ug
£157.00
RP00172-20UG
50 ug
£223.00
RP00172-50UG
100 ug
£336.00
RP00172-100UG
500 ug
£937.00
RP00172-500UG
1000 ug
£1478.00
RP00172-1000UG
About this Product
- SKU:
- RP00172
- Additional Names:
- MICA, MIC-A, PERB11.1, MHC class I polypeptide-related sequence A,MIC-A,PERB11.1
- Extra Details:
- MHC class I chain-related molecules A (MICA) is one of the genes in the HLA class I region, which belongs to MHC class I family. It is the member of the non-classical class I family that displays the greatest degree of polymorphism. The MICA protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
- Formulation:
- Recombinant Human MHC class I polypeptide-related sequence A/MIC-A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln308) of human MICA (Acc
- Immunogen:
- Met1-Gln308
- Molecular Weight:
- 50-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00172
