Recombinant Human MHC class I polypeptide-related sequence A/MIC-A Protein
Product Sizes
10 ug
£127.00
RP00172-10UG
20 ug
£157.00
RP00172-20UG
50 ug
£223.00
RP00172-50UG
100 ug
£336.00
RP00172-100UG
About this Product
- SKU:
- RP00172
- Additional Names:
- MICA, MIC-A, PERB11.1, MHC class I polypeptide-related sequence A,MIC-A,PERB11.1
- Extra Details:
- Recombinant Human MHC class I polypeptide-related sequence A/MIC-A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln308) of human MICA (Accession #NP_000238.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Gln308
- Molecular Weight:
- 35.88 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00172
