Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein
Product Sizes
10 ug
£133.00
RP00170-10UG
20 ug
£181.00
RP00170-20UG
50 ug
£240.00
RP00170-50UG
100 ug
£353.00
RP00170-100UG
About this Product
- SKU:
- RP00170
- Additional Names:
- JAM3,JAM-2,JAM-3,JAM-C,JAMC
- Extra Details:
- Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val32-Asn241 (Ala149Pro)) of human JAM3/JAM-C (Accession #NP_116190.3) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Val32-Asn241(A149P)
- Molecular Weight:
- 50.71 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKPVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00170








