Recombinant Human TREM-1/CD354 Protein
Product Sizes
10 ug
£133.00
RP00168-10UG
20 ug
£181.00
RP00168-20UG
50 ug
£240.00
RP00168-50UG
500 ug
£1002.00
RP00168-500UG
1000 ug
£1574.00
RP00168-1000UG
About this Product
- SKU:
- RP00168
- Additional Names:
- TREM1,CD354,TREM-1
- Extra Details:
- TREM1 (triggering receptor expressed on myeloid cells) is a type I transmembrane protein with a single Ig-like domain, and is selectively expressed on blood neutrophils and a subset of monocytes. As a member of the growing family of receptors related to NK cell receptors, TREM1 activates downstream signaling events with the help of an adapter protein called DAP12. T TREM1 amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers.
- Formulation:
- Recombinant Human TREM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Arg200) of human TREM1 (Accession #NP_061113.1) fused with an Fc, 6x
- Immunogen:
- Ala21-Arg200
- Molecular Weight:
- 60-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00168
