Recombinant Human TNFRSF12A/TWEAKR/CD266 Protein
Product Sizes
50 ug
£240.00
RP00166-50UG
100 ug
£353.00
RP00166-100UG
500 ug
£1002.00
RP00166-500UG
1000 ug
£1574.00
RP00166-1000UG
About this Product
- SKU:
- RP00166
- Additional Names:
- CD266, FN14, TWEAKR,TNFRSF12A,FN14,TWEAKR
- Extra Details:
- Fn14 (tumor necrosis factor receptor superfamily, member 12A), also known as TNFRSF12A, is the receptor for TNFSF12/TWEAK. Human and mouse TNFRSF12A share 82% aa sequence identity. TNFRSF12A transcript was expressed at high levels in heart, placenta, and kidney, at intermediate levels in lung, skeletal muscle, and pancreas, and at low levels in brain and liver. In addition, elevated TNFRSF12A expression was found in human liver cancer cell lines and hepatocellular carcinoma specimens. TNFRSF12A is the weak inducer of apoptosis in some cell types. It promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A may modulate cellular adhesion to matrix proteins.
- Formulation:
- Recombinant Human TNFRSF12A/TWEAKR/CD266 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu28-Trp79) of human TNFRSF12A/FN14/TWEAKR (Accession #NP_0577
- Immunogen:
- Glu28-Trp79
- Molecular Weight:
- 35-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 90 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00166
