Recombinant Human C1qR/CD93 Protein
Product Sizes
10 ug
£163.00
RP00164-10UG
20 ug
£223.00
RP00164-20UG
500 ug
£1478.00
RP00164-500UG
1000 ug
£2335.00
RP00164-1000UG
About this Product
- SKU:
- RP00164
- Additional Names:
- C1qR(P),C1QR1,C1qRP,CDw93,dJ737E23.1,ECSM3,MXRA4,CD93
- Extra Details:
- C1q R1, also known as CD93 and C1q Rp, is an approximately 125 kDa cell-surface glycoprotein and type I membrane protei. The protein expressed on monocytes, neutrophils, endothelial cells, and stem cells.CD93 was originally identified as a myeloid cell-specific marker. but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton.
- Formulation:
- Recombinant Human C1qR/CD93 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Lys580) of human CD93/C1QR1 (Accession #NP_036204.2) fused with
- Immunogen:
- Ala24-Lys580
- Molecular Weight:
- 110-130 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00164
