Recombinant Human Cell surface A33 antigen/GPA33 Protein
Product Sizes
10 ug
£133.00
RP00163-10UG
20 ug
£181.00
RP00163-20UG
50 ug
£240.00
RP00163-50UG
100 ug
£353.00
RP00163-100UG
About this Product
- SKU:
- RP00163
- Additional Names:
- A33,GPA33
- Extra Details:
- Recombinant Human Cell surface A33 antigen/GPA33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Val235) of human GPA33/Glycoprotein-A33 (Accession #NP_005805.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ile22-Val235
- Molecular Weight:
- 24.46 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00163




