Recombinant Human IL-18BP Protein
Product Sizes
100 ug
£240.00
RP00162-100UG
500 ug
£645.00
RP00162-500UG
1000 ug
£1002.00
RP00162-1000UG
About this Product
- SKU:
- RP00162
- Additional Names:
- IL18BP,IL18BPa
- Extra Details:
- Interleukin-18-binding protein (IL-18BP) is a constitutively expressed and secreted protein. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease.
- Formulation:
- Recombinant Human IL-18BP Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr31-Gly194) of human IL18BPa (Accession #NP_001034748.1) fused with an Fc, 6
- Immunogen:
- Thr31-Gly194
- Molecular Weight:
- 60-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00162
