Recombinant Human Activin RIIB/ACVR2B Protein
Product Sizes
10 ug
£127.00
RP00153-10UG
20 ug
£157.00
RP00153-20UG
50 ug
£223.00
RP00153-50UG
100 ug
£336.00
RP00153-100UG
500 ug
£937.00
RP00153-500UG
1000 ug
£1478.00
RP00153-1000UG
About this Product
- SKU:
- RP00153
- Additional Names:
- ACVR2B,ACTRIIB,ActR-IIB,HTX4
- Extra Details:
- Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
- Formulation:
- Recombinant Human Activin RIIB/ACVR2B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser19-Thr134) of human ACVR2B/Activin RIIB (Accession #NP_00
- Immunogen:
- Ser19-Thr134
- Molecular Weight:
- 55-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00153


