Recombinant Human Activin RIIB/ACVR2B Protein
Product Sizes
10 ug
£127.00
RP00153-10UG
20 ug
£157.00
RP00153-20UG
50 ug
£223.00
RP00153-50UG
100 ug
£336.00
RP00153-100UG
About this Product
- SKU:
- RP00153
- Additional Names:
- ACVR2B,ACTRIIB,ActR-IIB,HTX4
- Extra Details:
- Recombinant Human Activin RIIB/ACVR2B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser19-Thr134) of human ACVR2B/Activin RIIB (Accession #NP_001097.2) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser19-Thr134
- Molecular Weight:
- 40.12 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00153










