Recombinant Human FGFR-3 alpha (IIIc)/CD333 Protein
Product Sizes
50 ug
£223.00
RP00144-50UG
100 ug
£336.00
RP00144-100UG
500 ug
£907.00
RP00144-500UG
1000 ug
£1478.00
RP00144-1000UG
About this Product
- SKU:
- RP00144
- Additional Names:
- ACH,CD333,CEK2,HSFGFR3EX,JTK4,FGFR3
- Extra Details:
- FGFR3, also known as CD333, is a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. FGFRs are transmembrane catalytic receptors that have intracellular tyrosine kinase activity. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia.
- Formulation:
- Recombinant Human FGFR-3 alpha (IIIc)/CD333 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu23-Gly375) of human FGFR3/CD333 (Accession #NP_000133.1)
- Immunogen:
- Glu23-Gly375
- Molecular Weight:
- 100-120 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00144
