Recombinant Human TNFRSF6/FAS/CD95 Protein
Product Sizes
10 ug
£133.00
RP00139-10UG
50 ug
£240.00
RP00139-50UG
100 ug
£353.00
RP00139-100UG
500 ug
£1002.00
RP00139-500UG
1000 ug
£1574.00
RP00139-1000UG
About this Product
- SKU:
- RP00139
- Additional Names:
- ALPS1A,APO-1,APT1,CD95,FAS1,FASTM,TNFRSF6,FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6, Fas cell surface death receptor
- Extra Details:
- The protein is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
- Formulation:
- Recombinant Human TNFRSF6/FAS/CD95 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Asn173) of human FAS/CD95/APO-1/TNFRSF6 (Accession #NP_00
- Immunogen:
- Gln26-Asn173
- Molecular Weight:
- 55-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00139


