Recombinant Human TNFRSF6/FAS/CD95 Protein
Product Sizes
10 ug
£133.00
RP00139-10UG
50 ug
£240.00
RP00139-50UG
100 ug
£353.00
RP00139-100UG
About this Product
- SKU:
- RP00139
- Additional Names:
- ALPS1A,APO-1,APT1,CD95,FAS1,FASTM,TNFRSF6,FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6, Fas cell surface death receptor
- Extra Details:
- Recombinant Human TNFRSF6/FAS/CD95 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Asn173) of human FAS/CD95/APO-1/TNFRSF6 (Accession #NP_000034.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln26-Asn173
- Molecular Weight:
- 43.43 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00139
