Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein
Product Sizes
10 ug
£115.00
RP00136-10UG
20 ug
£145.00
RP00136-20UG
50 ug
£193.00
RP00136-50UG
100 ug
£276.00
RP00136-100UG
About this Product
- SKU:
- RP00136
- Additional Names:
- CD28,Tp44
- Extra Details:
- Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asn19-Pro152) of human CD28/TP44 (Accession #NP_006130.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asn19-Pro152
- Molecular Weight:
- 15.98 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00136
