Recombinant Human WAP5/WFDC2/HE4 Protein
Product Sizes
10 ug
£133.00
RP00132-10UG
20 ug
£181.00
RP00132-20UG
50 ug
£240.00
RP00132-50UG
100 ug
£353.00
RP00132-100UG
500 ug
£1240.00
RP00132-500UG
1000 ug
£1954.00
RP00132-1000UG
About this Product
- SKU:
- RP00132
- Additional Names:
- EDDM4, HE4, WAP5, dJ461P17.6,WFDC2,HE4,WAP5,dJ461P17.6
- Extra Details:
- The protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.
- Formulation:
- Recombinant Human WAP5/WFDC2/HE4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu31-Phe124) of human WAP5/WFDC2/HE4 (Accession #NP_006094.3) fused wi
- Immunogen:
- Glu31-Phe124
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00132
