Recombinant Human CEACAM3/CD66d Protein
Product Sizes
100 ug
£431.00
RP00131-100UG
About this Product
- SKU:
- RP00131
- Additional Names:
- CEACAM3,CD66D,CEA,CGM1,W264,W282
- Extra Details:
- Recombinant Human CEACAM3/CD66d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly155) of human CEACAM3/CD66d (Accession #NP_001806.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Gly155
- Molecular Weight:
- 17.62 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00131
