Recombinant Human CEACAM3/CD66d Protein
Product Sizes
100 ug
£431.00
RP00131-100UG
500 ug
£1240.00
RP00131-500UG
1000 ug
£1954.00
RP00131-1000UG
About this Product
- SKU:
- RP00131
- Additional Names:
- CEACAM3,CD66D,CEA,CGM1,W264,W282
- Extra Details:
- The protein encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described.
- Formulation:
- Recombinant Human CEACAM3/CD66d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly155) of human CEACAM3/CD66d (Accession #NP_001806.2) fused
- Immunogen:
- Met1-Gly155
- Molecular Weight:
- Approximately 20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00131
