Recombinant Human OX-2/CD200 Protein
Product Sizes
10 ug
£127.00
RP00127-10UG
20 ug
£175.00
RP00127-20UG
50 ug
£240.00
RP00127-50UG
100 ug
£336.00
RP00127-100UG
About this Product
- SKU:
- RP00127
- Additional Names:
- CD200,MOX1,MOX2,MRC,OX-2
- Extra Details:
- Recombinant Human OX-2/CD200 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln31-Gly232) of human CD200/OX-2 (Accession #NP_005935.4) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln31-Gly232
- Molecular Weight:
- 23.29 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00127
