Recombinant Human c-Kit ligand/KITLG/SCF Protein
Product Sizes
10 ug
£133.00
RP00124-10UG
20 ug
£181.00
RP00124-20UG
50 ug
£240.00
RP00124-50UG
100 ug
£353.00
RP00124-100UG
About this Product
- SKU:
- RP00124
- Additional Names:
- KITLG,DCUA,DFNA69,FPH2,FPHH,KL-1,Kitl,MGF,SCF,SF,SHEP7
- Extra Details:
- Recombinant Human c-Kit ligand/KITLG/SCF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-His214) of human SCF/C-kit ligand (Accession #NP_000890.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Glu26-His214
- Molecular Weight:
- 21.89 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00124










