Recombinant Human IL-3RA/CD123 Protein
Product Sizes
10 ug
£145.00
RP00121-10UG
20 ug
£193.00
RP00121-20UG
500 ug
£1240.00
RP00121-500UG
1000 ug
£1954.00
RP00121-1000UG
About this Product
- SKU:
- RP00121
- Additional Names:
- IL3RA,CD123,IL3R,IL3RAY,IL3RX,IL3RY,hIL-3Ra
- Extra Details:
- The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found.
- Formulation:
- Recombinant Human IL-3RA/CD123 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys20-Arg305) of human IL3RA/CD123 (Accession #NP_002174.1) fused with a
- Immunogen:
- Lys20-Arg305
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00121


