Recombinant Human IL-3RA/CD123 Protein
Product Sizes
10 ug
£145.00
RP00121-10UG
20 ug
£193.00
RP00121-20UG
About this Product
- SKU:
- RP00121
- Additional Names:
- IL3RA,CD123,IL3R,IL3RAY,IL3RX,IL3RY,hIL-3Ra
- Extra Details:
- Recombinant Human IL-3RA/CD123 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys20-Arg305) of human IL3RA/CD123 (Accession #NP_002174.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Lys20-Arg305
- Molecular Weight:
- 33.82 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00121
