Recombinant Human FCAR/CD89 Protein
Product Sizes
10 ug
£133.00
RP00113-10UG
20 ug
£181.00
RP00113-20UG
50 ug
£240.00
RP00113-50UG
About this Product
- SKU:
- RP00113
- Additional Names:
- FCAR,CD89,CTB-61M7.2,FcalphaRI
- Extra Details:
- Recombinant Human FCAR/CD89 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln22-Asn227) of human CD89/FCAR (Accession #NP_001991.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln22-Asn227
- Molecular Weight:
- 50.27 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00113
