Recombinant Human FCAR/CD89 Protein
Product Sizes
10 ug
£133.00
RP00113-10UG
20 ug
£181.00
RP00113-20UG
50 ug
£240.00
RP00113-50UG
500 ug
£1002.00
RP00113-500UG
1000 ug
£1574.00
RP00113-1000UG
About this Product
- SKU:
- RP00113
- Additional Names:
- FCAR,CD89,CTB-61M7.2,FcalphaRI
- Extra Details:
- This protein is a member of the immunoglobulin gene superfamily and receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Formulation:
- Recombinant Human FCAR/CD89 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln22-Asn227) of human CD89/FCAR (Accession #NP_001991.1) fused with an Fc,
- Immunogen:
- Gln22-Asn227
- Molecular Weight:
- 65-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00113
