Recombinant Human Coagulation factor III/Tissue factor/CD142 Protein
Product Sizes
20 ug
£258.00
RP00112-20UG
50 ug
£383.00
RP00112-50UG
100 ug
£586.00
RP00112-100UG
500 ug
£1716.00
RP00112-500UG
1000 ug
£2716.00
RP00112-1000UG
About this Product
- SKU:
- RP00112
- Additional Names:
- CD142, TF, TFA,F3,TF,TFA
- Extra Details:
- The protein is coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.
- Formulation:
- Recombinant Human Coagulation factor III/Tissue factor/CD142 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly34-Glu251) of human Coagulation Fa
- Immunogen:
- Gly34-Glu251
- Molecular Weight:
- 35-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00112


