Recombinant Human Erythropoietin R/EPO-R Protein
Product Sizes
10 ug
£133.00
RP00111-10UG
20 ug
£181.00
RP00111-20UG
50 ug
£240.00
RP00111-50UG
100 ug
£353.00
RP00111-100UG
500 ug
£1002.00
RP00111-500UG
1000 ug
£1574.00
RP00111-1000UG
About this Product
- SKU:
- RP00111
- Additional Names:
- EPOR,EPO-R
- Extra Details:
- This protein is erythropoietin receptor which is a member of the cytokine receptor family. Upon erythropoietin binding, this receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Dysregulation of this gene may affect the growth of certain tumors. Alternate splicing results in multiple transcript variants.
- Formulation:
- Recombinant Human Erythropoietin R/EPO-R Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala25-Pro250) of human EPO Receptor/EPOR (Accession #NP_000112.
- Immunogen:
- Ala25-Pro250
- Molecular Weight:
- 55-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00111


