Recombinant Human Erythropoietin R/EPO-R Protein
Product Sizes
10 ug
£133.00
RP00111-10UG
20 ug
£181.00
RP00111-20UG
50 ug
£240.00
RP00111-50UG
100 ug
£353.00
RP00111-100UG
About this Product
- SKU:
- RP00111
- Additional Names:
- EPOR,EPO-R
- Extra Details:
- Recombinant Human Erythropoietin R/EPO-R Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala25-Pro250) of human EPO Receptor/EPOR (Accession #NP_000112.1) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS,0.1mM EDTA and 0.1% CHAPS,pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ala25-Pro250
- Molecular Weight:
- 51.32 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00111
