Recombinant Human Cystatin-C/CST3 Protein
Product Sizes
10 ug
£193.00
RP00110-10UG
20 ug
£258.00
RP00110-20UG
50 ug
£383.00
RP00110-50UG
About this Product
- SKU:
- RP00110
- Additional Names:
- ARMD11, HEL-S-2,CST3,HEL-S-2
- Extra Details:
- Recombinant Human Cystatin-C/CST3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Ala146) of human Cystatin C/CST3 (Accession #NP_000090.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Ala146
- Molecular Weight:
- 16.64 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00110
