Recombinant Human Basigin/EMMPRIN/CD147 Protein
Product Sizes
50 ug
£240.00
RP00104-50UG
100 ug
£353.00
RP00104-100UG
About this Product
- SKU:
- RP00104
- Additional Names:
- 5F7, CD147, EMMPRIN, OK, TCSF,BSG, 5F7, basigin,CD147,EMMPRIN,OK,TCSF,basigin
- Extra Details:
- Recombinant Human Basigin/EMMPRIN/CD147 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr25-His205) of human CD147/EMMPRIN/Basigin (Accession #NP_001719.2) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Thr25-His205
- Molecular Weight:
- 46.71 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00104
