Recombinant Human Cystatin-SN/CST1 Protein
Product Sizes
10 ug
£193.00
RP00100-10UG
20 ug
£258.00
RP00100-20UG
50 ug
£383.00
RP00100-50UG
100 ug
£586.00
RP00100-100UG
500 ug
£1716.00
RP00100-500UG
1000 ug
£2716.00
RP00100-1000UG
About this Product
- SKU:
- RP00100
- Additional Names:
- CST1
- Extra Details:
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid.
- Formulation:
- Recombinant Human Cystatin-SN/CST1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Trp21-Ser141) of human Cystatin SN/CST1 (Accession #NP_001889.2
- Immunogen:
- Trp21-Ser141
- Molecular Weight:
- Approximately 15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00100
