Recombinant Human IL-4R alpha/CD124 Protein
Product Sizes
10 ug
£145.00
RP00099-10UG
20 ug
£193.00
RP00099-20UG
50 ug
£288.00
RP00099-50UG
100 ug
£431.00
RP00099-100UG
500 ug
£1240.00
RP00099-500UG
1000 ug
£1954.00
RP00099-1000UG
About this Product
- SKU:
- RP00099
- Additional Names:
- IL4R,CD124,IL-4RA,IL4RA
- Extra Details:
- This protein is alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells.
- Formulation:
- Recombinant Human IL-4R alpha/CD124 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-His232) of human IL4R/CD124 (Accession #NP_000409.1) fus
- Immunogen:
- Gly24-His232
- Molecular Weight:
- 40-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00099
