Recombinant Human MBP-C/MBL-2 Protein
Product Sizes
10 ug
£133.00
RP00095-10UG
20 ug
£181.00
RP00095-20UG
100 ug
£353.00
RP00095-100UG
500 ug
£1240.00
RP00095-500UG
1000 ug
£1954.00
RP00095-1000UG
About this Product
- SKU:
- RP00095
- Additional Names:
- MBL2,COLEC1,HSMBPC,MBL,MBL2D,MBP,MBP-C,MBP1,MBPD
- Extra Details:
- This protein is soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
- Formulation:
- Recombinant Human MBP-C/MBL-2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu21-Ile248) of human MBL2/MBL/COLEC1 (Accession #NP_000233.1) fused with
- Immunogen:
- Glu21-Ile248
- Molecular Weight:
- 30-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00095
