Recombinant Human Ephrin-B1/EFNB1 Protein
Product Sizes
20 ug
£181.00
RP00092-20UG
50 ug
£240.00
RP00092-50UG
100 ug
£353.00
RP00092-100UG
About this Product
- SKU:
- RP00092
- Additional Names:
- EFNB1,CFND,CFNS,EFB1,EFL3,EPLG2,Elk-L,LERK2,ephrin-B1
- Extra Details:
- Recombinant Human Ephrin-B1/EFNB1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu 28 - Gly 232 ) of human Ephrin-B1 (Accession #NP_004420.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Leu28-Gly232
- Molecular Weight:
- 23.24 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00092
