Recombinant Human Leukemia inhibitory factor/LIF Protein
Product Sizes
10 ug
£127.00
RP00089-10UG
20 ug
£157.00
RP00089-20UG
50 ug
£223.00
RP00089-50UG
100 ug
£336.00
RP00089-100UG
500 ug
£907.00
RP00089-500UG
1000 ug
£1478.00
RP00089-1000UG
About this Product
- SKU:
- RP00089
- Additional Names:
- LIF,CDF,DIA,HILDA,MLPLI
- Extra Details:
- The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Formulation:
- Recombinant Human Leukemia inhibitory factor/LIF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser23-Phe202) of human LIF (Accession #NP_002300.1) fus
- Immunogen:
- Ser23-Phe202
- Molecular Weight:
- 33-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00089
