Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein
Product Sizes
10 ug
£133.00
RP00081-10UG
20 ug
£181.00
RP00081-20UG
50 ug
£265.00
RP00081-50UG
100 ug
£353.00
RP00081-100UG
500 ug
£1002.00
RP00081-500UG
1000 ug
£1574.00
RP00081-1000UG
About this Product
- SKU:
- RP00081
- Additional Names:
- FCGR2A,CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2
- Extra Details:
- The member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
- Formulation:
- Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218 (R167)) of human Fc gamma RIIA/C
- Immunogen:
- Ala36-Ile218(H167R)
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00081


