Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein

Product Sizes

10 ug

£133.00

RP00081-10UG

20 ug

£181.00

RP00081-20UG

100 ug

£353.00

RP00081-100UG

About this Product

SKU:: RP00081
Additional Names:: FCGR2A,CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2
Extra Details:: Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218 (R167)) of human Fc gamma RIIA/CD32a (Accession #NP_001129691.1) fused with a 6xHis tag at the C-terminus.
Formulation:: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Immunogen:: Ala36-Ile218(H167R)
Molecular Weight:: 21.15 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket