Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
Product Sizes
10 ug
£133.00
RP00075-10UG
50 ug
£240.00
RP00075-50UG
100 ug
£353.00
RP00075-100UG
500 ug
£1002.00
RP00075-500UG
1000 ug
£1574.00
RP00075-1000UG
About this Product
- SKU:
- RP00075
- Additional Names:
- FCGR2B,CD32,CD32B,FCG2,FCGR2,IGFR2
- Extra Details:
- The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.
- Formulation:
- Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala46-Pro217) of human Fc gamma RIIB/C (Accession #NP_00399
- Immunogen:
- Ala46-Pro217
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00075
