Recombinant Human Ep-CAM/TROP-1/CD326 Protein
Product Sizes
10 ug
£133.00
RP00073-10UG
20 ug
£181.00
RP00073-20UG
50 ug
£240.00
RP00073-50UG
100 ug
£353.00
RP00073-100UG
About this Product
- SKU:
- RP00073
- Additional Names:
- DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1,EPCAM, DIAR5, epithelial cell adhesion molecule,EGP-2,EGP314,EGP40,ESA,HNPCC8,KS1/4,KSA,M4S1,MIC18,MK-1,TACSTD1,TROP1
- Extra Details:
- Recombinant Human Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Lys265) of human EpCAM/TROP-1 (Accession #NP_002345.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln24-Lys265
- Molecular Weight:
- 28.26 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00073




