Recombinant Human R-spondin-1/RSPO1 Protein
Product Sizes
10 ug
£145.00
RP00071-10UG
20 ug
£193.00
RP00071-20UG
50 ug
£288.00
RP00071-50UG
100 ug
£431.00
RP00071-100UG
About this Product
- SKU:
- RP00071
- Additional Names:
- RSPO1,CRISTIN3,RSPO
- Extra Details:
- Recombinant Human R-spondin-1/RSPO1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg31-Ala263) of human R-Spondin1 (Accession #NP_001033722.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Arg31-Ala263
- Molecular Weight:
- 26.44 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00071








