Recombinant Human FGF-12 Protein
Product Sizes
10 ug
£133.00
RP00064-10UG
20 ug
£181.00
RP00064-20UG
About this Product
- SKU:
- RP00064
- Additional Names:
- FGF12,EIEE47,FGF12B,FHF1
- Extra Details:
- Recombinant Human FGF-12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Thr181) of human FGF-12 (Accession #NP_004104.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, 1mM DTT, 300mM NaCl, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Thr181
- Molecular Weight:
- 21.26 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00064
