Recombinant Human Bcl-2 Protein
Product Sizes
10 ug
£145.00
RP00062-10UG
20 ug
£193.00
RP00062-20UG
50 ug
£288.00
RP00062-50UG
100 ug
£431.00
RP00062-100UG
500 ug
£1265.00
RP00062-500UG
1000 ug
£1979.00
RP00062-1000UG
About this Product
- SKU:
- RP00062
- Additional Names:
- BCL2, Bcl-2, PPP1R50, apoptosis regulator Bcl-2,Bcl-2,PPP1R50
- Extra Details:
- This protein is an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma.
- Formulation:
- Recombinant Human Bcl-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Asp211) of human BCL2 (Accession #NP_000624.2) fused with no tags.
- Immunogen:
- Ala2-Asp211
- Molecular Weight:
- 25-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00062
