Recombinant Human Bcl-2 Protein
Product Sizes
10 ug
£145.00
RP00062-10UG
20 ug
£193.00
RP00062-20UG
50 ug
£288.00
RP00062-50UG
100 ug
£431.00
RP00062-100UG
About this Product
- SKU:
- RP00062
- Additional Names:
- BCL2, Bcl-2, PPP1R50, apoptosis regulator Bcl-2,Bcl-2,PPP1R50
- Extra Details:
- Recombinant Human Bcl-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Asp211) of human BCL2 (Accession #NP_000624.2) fused with no tags.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM HEPES,50mM KCl,pH 7.5.Contact us for customized product form or formulation.
- Immunogen:
- Ala2-Asp211
- Molecular Weight:
- 23.18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00062
