Recombinant Human TNFSF9/4-1BB Ligand Protein
Product Sizes
10 ug
£133.00
RP00060-10UG
20 ug
£181.00
RP00060-20UG
50 ug
£240.00
RP00060-50UG
100 ug
£353.00
RP00060-100UG
500 ug
£1002.00
RP00060-500UG
1000 ug
£1574.00
RP00060-1000UG
About this Product
- SKU:
- RP00060
- Additional Names:
- 4-1BB-L, CD137L, TNLG5A,TNFSF9,CD137L,TNLG5A
- Extra Details:
- The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.
- Formulation:
- Recombinant Human TNFSF9/4-1BB Ligand Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg71-Glu254) of human 4-1BB Ligand/TNFSF9 (Accession #NP_003802.
- Immunogen:
- Arg71-Glu254
- Molecular Weight:
- 18-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00060
