Recombinant Human Neddylin/NEDD8 Protein
Product Sizes
10 ug
£107.00
RP00059-10UG
20 ug
£133.00
RP00059-20UG
50 ug
£163.00
RP00059-50UG
500 ug
£645.00
RP00059-500UG
1000 ug
£1002.00
RP00059-1000UG
About this Product
- SKU:
- RP00059
- Additional Names:
- NEDD8,NEDD-8
- Extra Details:
- Neural Precursor Cell Expressed Developmentally Downregulated Gene 8 (NEDD8), also known as Related to Ubiquitin 1 (Rub1), is a 6-8 kDa member of the Ubiquitin family of proteins. Human NEDD8 is activated by a distinct NEDD8-activating (E1) enzyme, a heterodimeric complex composed of APPBP1 and UBA3 subunits . Activated NEDD8 is subsequently transferred to the UBE2M/Ubc12 or UBE2F NEDD8-conjugating (E2) enzymes . Through a process termed neddylation, the ROC1/Rbx1 RING Finger E3 ligase transfers NEDD8 to specific substrates. NEDD8 plays a critical regulatory role in cell proliferation and dysregulation of the NEDD8 pathway has been associated with several cancer pathologies .
- Formulation:
- Recombinant Human Neddylin/NEDD8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly76) of human NEDD8 (Accession #NP_006147.1) fused with a 6xHis
- Immunogen:
- Met1-Gly76
- Molecular Weight:
- 9 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00059




