Recombinant Human Oncostatin-M/OSM Protein
Product Sizes
10 ug
£145.00
RP00054-10UG
20 ug
£193.00
RP00054-20UG
50 ug
£264.00
RP00054-50UG
100 ug
£395.00
RP00054-100UG
About this Product
- SKU:
- RP00054
- Additional Names:
- OSM, oncostatin-M
- Extra Details:
- Recombinant Human Oncostatin-M/OSM Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala26-Arg221) of human Oncostatin-M/OSM (Accession #NP_065391.1).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, 5% glycerol, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ala26-Arg221
- Molecular Weight:
- 22.15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00054
