Recombinant Human Oncostatin-M/OSM Protein
Product Sizes
10 ug
£145.00
RP00054-10UG
20 ug
£193.00
RP00054-20UG
50 ug
£264.00
RP00054-50UG
100 ug
£395.00
RP00054-100UG
500 ug
£1157.00
RP00054-500UG
1000 ug
£1812.00
RP00054-1000UG
About this Product
- SKU:
- RP00054
- Additional Names:
- OSM, oncostatin-M
- Extra Details:
- This protein is a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family. The preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells.
- Formulation:
- Recombinant Human Oncostatin-M/OSM Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala26-Arg221) of human Oncostatin-M/OSM (Accession #NP_065391.1).
- Immunogen:
- Ala26-Arg221
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00054




