Recombinant Human TNFSF15/TL1 Protein
Product Sizes
10 ug
£145.00
RP00053-10UG
20 ug
£193.00
RP00053-20UG
50 ug
£288.00
RP00053-50UG
100 ug
£431.00
RP00053-100UG
About this Product
- SKU:
- RP00053
- Additional Names:
- TNFSF15,TL1,TL1A,TNLG1B,VEGI,VEGI192A
- Extra Details:
- Recombinant Human TNFSF15/TL1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Leu72-Leu251) of human TL1A/TNFSF15 (Accession #NP_005109.2) fused with an initial Met at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 50mM NaCl, 5% glycerol, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Leu72-Leu251
- Molecular Weight:
- 20.47 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00053










