Recombinant Human IL-8/CXCL8/GCP-1 Protein
Product Sizes
10 ug
£133.00
RP00052-10UG
20 ug
£181.00
RP00052-20UG
50 ug
£240.00
RP00052-50UG
100 ug
£353.00
RP00052-100UG
500 ug
£1002.00
RP00052-500UG
1000 ug
£1574.00
RP00052-1000UG
About this Product
- SKU:
- RP00052
- Additional Names:
- CXCL8,GCP-1,GCP1,IL8,LECT,LUCT,LYNAP,MDNCF,MONAP,NAF,NAP-1,NAP1
- Extra Details:
- The protein is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.
- Formulation:
- Recombinant Human IL-8/CXCL8/GCP-1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala23-Ser99) of human IL-8 (Accession #NP_000575.1).
- Immunogen:
- Ala23-Ser99
- Molecular Weight:
- 10 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00052




