Recombinant Human IL-11 Protein
Product Sizes
10 ug
£145.00
RP00050-10UG
20 ug
£193.00
RP00050-20UG
50 ug
£288.00
RP00050-50UG
100 ug
£431.00
RP00050-100UG
About this Product
- SKU:
- RP00050
- Additional Names:
- IL11,AGIF,IL-11
- Extra Details:
- Recombinant Human IL-11 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro22-Leu199) of human IL-11 (Accession #NP_000632.1) fused with an initial Met at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Pro22-Leu199
- Molecular Weight:
- 19.14 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00050
